Tarrant county civil court records. Tom Vandergriff Civil Courts Building.
Tarrant county civil court records Feb 27, 2025 · Tom Vandergriff Civil Courts Building 100 North Calhoun Street. Sep 1, 2017 · The Justice Court is commonly known as the “People’s Court”. Nov 7, 2022 · Tarrant County Civil Docket, Precinct One, Volume A, 1876-1877. The Tarrant County Courts are housed in the Tarrant County Courthouse, the Tim Curry Justice Center, Tom Vandergriff Civil Courts Building and the Family Courts Center. The Tarrant County Court system is comprised of Civil Courts, Criminal Courts, Family Courts, Juvenile Court, Probate Courts and the Justices of the Peace. 4 days ago · Every effort is made to ensure that information provided is correct. Dockets are usually managed by the Clerk of Court. Every effort is made to ensure that information provided is correct. 5 days ago · County Telephone Operator 817-884-1111 Tarrant County provides the information contained in this web site as a public service. Fax 817-884-2384. Texas Practice Guide KFT 1280. A confidential court record is a court document that is closed to the public or only accessible to the parties to the case. The county clerk keeps case records from the county courts, county courts at law, and probate courts, including: civil cases; criminal cases; probate Jan 5, 2022 · Tom Vandergriff Civil Courts Building 100 N. 4th Floor. gov By fax to 817. 48th District Court. Calhoun Street Fort Worth, Texas 76196 the official records of Tarrant County should be consulted. The Tarrant County Civil Docket, Precinct One, contains information on court cases including the names of the plaintiff and defendant, names of attorneys, justice's cost, constable's cost, description of suit. Please be advised that on January 1, 2022, in accordance with S. Also learn about Tarrant County criminal court records, Tarrant County civil court records, the information that a Tarrant County court case search provides, how to get Tarrant County court records online for free and Tarrant County court locations as well as the contact information of Tarrant County clerks. Learn about the local rules, filing procedures, and docket for the Civil District Courts. Tom Vandergriff Civil Courts Building, 100 N. Jan 5, 2022 · As of February 12, 2010, members of the community have the opportunity to view and obtain copies of documents from cases filed with the Tarrant County District Clerk's office. Civil court records are materials and documents from non-criminal legal Tarrant County, with a population of approximately 2. Nov 30, 2021 · MANDATORY CIVIL E-FILING IN TARRANT COUNTY *** Please See Notice Below Regarding the New eFile Reviewer Tool *** eFile Reviewer Tool Notice In December 2012, the Texas Supreme Court mandated e-filing in civil matters. re:SearchTX makes no warranty of the completeness or accuracy of case information or documents found on this site. Individuals seeking to confirm qualifications for full access to Tarrant County divorce records should gather the necessary documents (this includes government-issued identifications, attorney credentials, and court orders) and submit formal requests through the Tarrant County District Clerk's Office at: Tarrant County Justice of the Peace Courts handle class C criminal misdemeanor cases. You may search for your case using the court's full case number (JP05-17-SC0000xxxx) or the party name. The office also produces a substantial number of court documents including civil citations, criminal warrants, criminal judgments and sentences. Tom Vandergriff Civil Courts Building - 4th Floor 100 North Calhoun Street Fort Worth, TX 76196. Civil Division - Probate Clerks. There are eight Justice Courts in Tarrant County. Information seekers should note that access to Tarrant County criminal records may require valid identification and fee payments. 884. Civil District Dockets These statutes provide that the court has jurisdiction over civil causes and proceedings, original and appellate, as prescribed by law for county courts, including jurisdiction over appeal from the Justice of the Peace courts. Public court records are available for online viewing at no cost. To obtain copies of court filed public records from a civil case go to the County Court at Law webpage. Feb 26, 2025 · Tarrant County provides the information contained in this web site as a public service. T4931 Aug 1, 2017 · You will need to select the court location, and then click on either Criminal Case Records or Case Records Search. gov . These officials include the Commissioners' Court, the sheriff, the district and county clerks, the county auditor, and the purchasing agent, among others. For online court records, the information includes the offender’s name, DOB, charges, timeline of court appearances, attorneys, and upcoming court hearings. 242). Aug 24, 2023 · County Telephone Operator 817-884-1111 Tarrant County provides the information contained in this website as a public service. Consequently, individuals can search for a Tarrant County family court case through the Tarrant County District Clerk's Office. Court Email. Feb 11, 2022 · Tom Vandergriff Civil Courts Building 100 N. Calhoun, Second Floor Fort Worth, TX 76196 817-884-1240 County Telephone Operator 817-884-1111 Tarrant County provides the information contained in this website as a public service. Mar 22, 2023 · Find information on civil law issues, virtual court procedures, and how to access case information online in Tarrant County. 1675 Tarrant County, Texas, the third largest county in Texas, has a diverse and complex court system. B. Notice of Agreed Judges Order Regarding Distrution of JP Appeals, Foricible Detainer, and Occupational Driver License cases-Effective September 12, 2022 ***Change to Citation by Publication Process*** County Court At Law No. GENERAL MATTERS. 14 Sealing of Court Records . Members of the public can use the Tarrant County Case Search or County Courts - Class “C” Browse online databases to look up these records. Feb 6, 2025 · Court Documents CIVIL. 3 has jurisdiction over the following cases or controversies: Jan 22, 2025 · County Telephone Operator 817-884-1111 Tarrant County provides the information contained in this website as a public service. 1876-1877. Civil District Dockets County Telephone Operator 817-884-1111 Tarrant County provides the information contained in this website as a public service. 67th District Court. Fines are paid at the Tim Curry Justice Center. Tarrant County Courthouse 100 West Weatherford - Room 290A Fort Worth, TX 76196-0240 These statutes provide that the court has jurisdiction over civil causes and proceedings, original and appellate, as prescribed by law for county courts, including jurisdiction over appeal from the Justice of the Peace courts. Court records are documents filed during court cases. 817-884-2730. Aug 21, 2019 · With 60,000 cases being filed each year into the 27 civil, family and criminal District courts in Tarrant County, good computer automation is a necessity, not a luxury. 817-884-1813. County Court at Law No. Jan 1, 2022 · Civil Division - County Court at Law Clerks. Mar 11, 2025 · The phone number for Tarrant County 17th District Court - Civil is 817-884-1567 Notice The information on this website is taken from records made available by state and local law enforcement departments, courts, city and town halls, and other public and private sources. tarrantcounty. Feb 5, 2025 · Some counties make their court records searchable on the county clerk's website. . You may call our Civil Department at 817-884-1101 or use our “Live Chat” option on our webpage to check for a pending case. 817-884-2690 Civil District Dockets Mar 9, 2025 · The phone number for Tarrant County 153rd District Court - Civil is 817-884-1592 Notice The information on this website is taken from records made available by state and local law enforcement departments, courts, city and town halls, and other public and private sources. These cases include Civil, Family and Criminal (Felony) cases. Get Tarrant County Civil Court Records. The County Clerk's office keeps records for the County Criminal Courts where misdemeanors and appeals are filed. W52 • §1. 2 will grant most unopposed occupational driver's licenses without a hearing. Judge Don Pierson Tarrant County Courthouse 100 West Weatherford - Room 490 Fort Worth, TX 76196-0240. Aug 24, 2023 · Case records and calendars for all County Courts at Law, Probate Courts, and Justice of the Peace Courts are searchable by going to the following page: https://odyssey. Tarrant County criminal records are also available through third-party platforms such as Texascourtrecords. Judge Don Cosby Tom Vandergriff Civil Courts Building - 4th Floor Court Records: Free Online Search for Digital Copies. Available records include civil, delinquent tax, family, felony, and misdemeanor. 817-884-2690. 817-884-2691. Court Jul 12, 2024 · The County Clerk issues and maintains all marriage licenses in Tarrant County. Honorable Christopher Taylor. Notice of Agreed Judges Order Regarding Distrution of JP Appeals, Foricible Detainer, and Occupational Driver License cases-Effective September 12, 2022 ***Change to Citation by Publication Process*** Aug 30, 2023 · COURT LOCATION. Fort Worth, TX, 76196. Oct 16, 2024 · County Telephone Operator 817-884-1111 Tarrant County provides the information contained in this website as a public service. Aug 30, 2023 · You must apply to the convicting court. A19O3 • Ch. Judge Don Cosby Tom Vandergriff Civil Courts Building - 4th Floor County Court At Law No. Search Tarrant County Civil Right Court Records for Free. With tens of thousands of criminal and civil cases processed every year, there is a high demand for court services. Civil District Dockets Feb 5, 2025 · Some counties make their court records searchable on the county clerk's website. Sep 1, 2023 · County Telephone Operator 817-884-1111 Tarrant County provides the information contained in this website as a public service. O’Connor’s Texas Rules Civil Trials KFT 1729. Feb 26, 2025 · County Telephone Operator 817-884-1111 Tarrant County provides the information contained in this website as a public service. Texas Litigation Guide KFT 1730. Judge Mike Hrabal Tarrant Tom Vandergriff Civil Courts Building 5th Floor 100 North Calhoun Street Fort Worth, TX 76196 . To research the history of the District and Criminal District Courts of Tarrant County, please click on link here: District Court History The Tarrant County Court system is comprised of Civil Courts, Criminal Courts, Family Courts, Juvenile Court, Probate Courts and the Justices of the Peace. 2. In addition, Tarrant County Court at Law No. Family Court Records: such as records of proceedings on custody and divorce ; Probate Court Records: including records of wills and estate, name change, and guardianship; Confidential Court Records in Tarrant County. They can physically District Courts are the trial courts of general jurisdiction, and each county must be served by at least one District Court. Nov 5, 2024 · County Telephone Operator 817-884-1111 Tarrant County provides the information contained in this website as a public service. Such wills can only be accessed with a testator or court's permission. Tarrant County is not responsible for the content of, nor endorses any site which has a link from the Tarrant County website. Judge Chris Taylor. In Tarrant County, dockets are managed by the Court Coordinators for the individual courts. Texas Civil Trial and Appellate Procedure KFT 1738. 3. Petitioners must be Tarrant County residents for seeking a license as a result of a suspension arising out of a law enforcement action in Tarrant County (Texas Transportation Code 521. us. 335 pages. 817-884-1460. Feb 26, 2025 · Tarrant County is not responsible for the content of, nor endorses any site which has a link from the Tarrant County web site. As clerk of the three County Courts at Law, the County Clerk is responsible for the intake, processing and maintenance of civil cases with a jurisdictional limit up to $250,000; including debt, breach of contract, garnishments, temporary restraining orders, injunctions, automotive/personal injury cases and eminent domain cases, as well as Aug 2, 2017 · To file an open records request with Tarrant County, please submit a written request in one of the following ways: By e-mail to openrecords@tarrantcountytx. 342dc@tarrantcountytx. 1 million residents in 902 square miles, is the third most populous county in the state of Texas. Please contact the clerk to obtain an official copy of a document. Court Phone Number Aug 7, 2015 · County Telephone Operator 817-884-1111 Tarrant County provides the information contained in this website as a public service. Sep 1, 2016 · County Telephone Operator 817-884-1111 Tarrant County provides the information contained in this website as a public service. com/publicaccess/ Dec 29, 2022 · Our Criminal Department will call to discuss payment of fines and fees on disposed Class A and B misdemeanor cases. Larger counties with online databases include Bexar, Collin, Dallas, Denton, Harris, Tarrant, and Travis counties. 100 North Calhoun Street Fort Worth, TX 76196. Aug 2, 2023 · Family Law Center Court Locator; Civil Courts Building To visit a specific court's web site, please go to: Tarrant County Courts (this link will take you away from the District Clerk web site). , 2nd Floor, Fort Worth, Texas 76196, Contact Us 4 days ago · County Telephone Operator 817-884-1111 Tarrant County provides the information contained in this website as a public service. Lookup Civil Right Cases, Access Case Online, Find Docket Information, View Case Summary, Check Case Status, Download Court Documents, & More. By subscribing to this service, attorneys will have the ability to view and print (see exceptions below) documents from civil and probate cases. The first group of counties (Harris, Dallas, Tarrant, Bexar, Travis, Collin, Denton, El Paso, Hidalgo and Fort Bend), the Supreme Court, the Court of Criminal Appeals and the 14 Sep 6, 2019 · The Tarrant County Clerk’s Office is now offering attorneys remote access to civil and probate case files. , 2nd Floor, Fort Worth, Texas 76196, Contact Us The docket number may contain a number or letter to signify the court, a 2-digit number that indicates the year, the case type, a case number, and the initials of the judge. A marriage license requires a 72-hour waiting period and the marriage ceremony must take place within 90 days from date of issuance. Tom Vandergriff Civil Courts Building - 3rd Floor 100 North Calhoun Street Fort Worth, TX 76196. Judge Mike Hrabal Tarrant Tom Vandergriff Civil Courts Building 5th Floor 100 North Calhoun Street Fort Worth, TX 76196 Court Email. 41, the filing fee for Justice Court civil suits will increase from $46 to $54. Tom Vandergriff Civil Courts Building 4th Floor 100 North Calhoun Street Fort Worth, TX 76196 817-884-2685. Weatherford Fort Worth, TX 76196 817-884-1195 Tarrant County is not responsible for the content of, nor endorses any site which has a link from the Tarrant County web site. Tarrant County is Aug 2, 2023 · Family Law Center Court Locator; Civil Courts Building To visit a specific court's web site, please go to: Tarrant County Courts (this link will take you away from the District Clerk web site). Judge Jennifer Rymell Tarrant County Courthouse 100 West Weatherford - Room 240A Fort Worth, TX 76196-0240. District Courts: The civil division of the Tarrant County District Clerk maintains all documents filed in civil cases heard by the District Courts. Tom Vandergriff Civil Courts Building 3rd Floor 100 North Calhoun Street Fort Worth, TX 76196 . However, in any case where legal reliance on information contained in these pages is required, the official records of Tarrant County should be consulted. Room 233 Tarrant County Old Courthouse 100 West Weatherford Street Fort Worth, Texas 76196 817-884-1770 ***Change to Citation by Publication Process*** County Telephone Operator 817-884-1111 Tarrant County provides the information contained in this website as a public service. As clerk of the three County Courts at Law, the County Clerk is responsible for the intake, processing and maintenance of civil cases with a jurisdictional limit up to $250,000; including debt, breach of contract, garnishments, temporary restraining orders, injunctions, automotive/personal injury cases and eminent domain cases, as well as Nov 9, 2020 · County Telephone Operator 817-884-1111 Tarrant County provides the information contained in this website as a public service. Deeds, plats, liens, powers of attorney, oil and gas leases, and many other documents. 6, Ch. 817-884-1457. Family court matters are handled by the various district courts in Tarrant County. Court Phone Number Jun 9, 2023 · County Telephone Operator 817-884-1111 Tarrant County provides the information contained in this website as a public service. Tarrant County Family Court Case Search. The phone number is 817-884-1240. Room 250 Tarrant County Old Courthouse 100 West Weatherford Street Fort Worth, Texas 76196 817-884-1101. 25 Sealing Court Records . , 2nd Floor, Fort Worth, Texas 76196, Contact Us Feb 26, 2025 · Tarrant County is not responsible for the content of, nor endorses any site which has a link from the Tarrant County web site. To research the history of the District and Criminal District Courts of Tarrant County, please click on link here: District Court History Mary Louise Nicholson County Clerk 100 W. Jan 29, 2016 · County Telephone Operator 817-884-1111 Tarrant County provides the information contained in this website as a public service. The Justice Court is a trial court for both civil cases (jurisdictional limit is $20,000), and many different types of misdemeanor criminal cases. 97 §97. 1. County Court At Law No. The clerk of the court is the official custodian of the court's records. Calhoun St. If you need a digital version of public court records, this option is for you. Tom Vandergriff Civil Courts Building. The county clerk keeps case records from the county courts, county courts at law, and probate courts, including: civil cases; criminal cases; probate Search Tarrant County District Court and Criminal District Court records through this paid subscription service offering access to case information about criminal, civil, and family cases. Mar 6, 2025 · County Telephone Operator 817-884-1111 Tarrant County provides the information contained in this website as a public service. Many court records can be viewed online from the Tarrant County Courts website. The costs of accessing criminal records in Tarrant County depend on the source of the documents. T4 • Vol. Judge Mike Hrabal Tarrant 5 days ago · The phone number for Tarrant County 352nd District Court - Civil is 817-884-1183 Notice The information on this website is taken from records made available by state and local law enforcement departments, courts, city and town halls, and other public and private sources. Now attorneys, employers, and the general public can do background checks from their own office. 5L Motion to Seal Court Records . You may be able to find the information you’re looking for without contacting our office. 2 has jurisdiction over the following cases or controversies: Feb 6, 2025 · The Civil Division of the Tarrant County District Attorney's Office acts as General Counsel for Tarrant County and its elected or appointed officials, providing legal advice. Feb 15, 2025 · Tarrant County is not responsible for the content of, nor endorses any site which has a link from the Tarrant County web site. District Court has original jurisdiction in divorce cases, felony criminal cases, civil cases involving more than $200, cases contesting elections, juvenile matters and family law, and land disputes. The Texas legislature, to manage its large population and greater administrative needs, created statutory County Courts that have original and appellate jurisdiction over civil and criminal cases prescribed by law for county courts. Tarrant County District Clerk manages most of the business operations for the 27 District Courts in Tarrant County that hear Civil, Family and Felony Criminal cases. County Telephone Operator 817-884-1111 Tarrant County provides the information contained in this website as a public service. , 2nd Floor, Fort Worth, Texas 76196, Contact Us Search Tarrant County District Court and Criminal District Court records through this paid subscription service offering access to case information about criminal, civil, and family cases. Your Justice Court Judge also serves as an Administrative Hearing Judge. anzsfvvckbfvcdgqcufddxtnplnesaxpcinktlnczebmvpefikgnlsmdfhwarctqnavwtfcnlg
We use cookies to provide and improve our services. By using our site, you consent to cookies.
AcceptLearn more